PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.5022s0117.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family GeBP
Protein Properties Length: 352aa    MW: 39324 Da    PI: 6.1268
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.5022s0117.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57394.61e-2968162298
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                          lf r+w+eeDe++lL+Gl+d+kak g + + d dafy+f+ +si +k+sk+q+ +Kir+L+ +f  + +k+++g++   ++++++++f+l
  Bostr.5022s0117.1.p  68 LFIRIWNEEDELALLKGLVDYKAKSGYNTKIDRDAFYRFLGGSIVAKFSKNQVYSKIRKLRSRFLVHLEKTNEGND--SKSSSYSEAFGL 155
                          688*******************************************************************777777..6778889***** PP

               DUF573  92 skkiWgs 98 
                          s++iWg+
  Bostr.5022s0117.1.p 156 SMMIWGQ 162
                          *****96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045046.2E-2370161IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MPPKIMVSPK QLNLSSSGGA GDCDDTFARR KSLRNFSSKR AASDAAEEET KKKKKKTKKE  60
KTKSDSPLFI RIWNEEDELA LLKGLVDYKA KSGYNTKIDR DAFYRFLGGS IVAKFSKNQV  120
YSKIRKLRSR FLVHLEKTNE GNDSKSSSYS EAFGLSMMIW GQNQAEFAHD DDGISKEMLK  180
EHEEPINENG ALIITDNGTA RVAQQSESGE EMLKENEEPV NENGAVIITD NGTARVAQQS  240
ESGEEMLKEH EEKRVNENEA AKTTESGTNA GKESHDDDDE LCAVRDAFKS VMSQGLSDYQ  300
KKLQLEKLMN IGTGKRRELS NEWKALCVEE GRLKIMKLRF SVKLAEAAND S*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15058KKKKKKTKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0060534e-92AC006053.3 Arabidopsis thaliana chromosome 2 clone F3N11 map B68, complete sequence.
GenBankAY0964174e-92AY096417.1 Arabidopsis thaliana unknown protein (At2g25650) mRNA, complete cds.
GenBankCP0026854e-92CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565602.11e-135DNA-binding storekeeper protein-related transcriptional regulator
TrEMBLQ8VYD21e-135Q8VYD2_ARATH; DNA-binding storekeeper protein-related transcriptional regulator
STRINGAT2G25650.11e-134(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61171741
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25650.11e-137DNA-binding storekeeper protein-related transcriptional regulator